PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_03529.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 343aa    MW: 38741.3 Da    PI: 5.4289
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_03529.1_g00003.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.23.2e-5361331128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              lppGfrFhPtd+elv +yLk+k+++ ++el evi+ +d+yk++PwdLp k  + + + ewyfF++rdkky++g+r+nrat+sgyWk
  Sme2.5_03529.1_g00003.1   6 LPPGFRFHPTDQELVGYYLKRKADELEIEL-EVIPVIDLYKFDPWDLPeKsFLPKCDMEWYFFCSRDKKYPNGSRTNRATNSGYWK 90 
                              79****************************.99**************95344445678**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              atgkdk+v++ k ++vg +ktLvfy+grap g +tdWvmheyrl
  Sme2.5_03529.1_g00003.1  91 ATGKDKKVVC-KPAVVGYRKTLVFYRGRAPFGDRTDWVMHEYRL 133
                              **********.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.41E-614156IPR003441NAC domain
PROSITE profilePS5100557.3166156IPR003441NAC domain
PfamPF023651.8E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MAGISLPPGF RFHPTDQELV GYYLKRKADE LEIELEVIPV IDLYKFDPWD LPEKSFLPKC  60
DMEWYFFCSR DKKYPNGSRT NRATNSGYWK ATGKDKKVVC KPAVVGYRKT LVFYRGRAPF  120
GDRTDWVMHE YRLCDDVSQG TSSFQGPFAL CRVIKRKDNI SLKTSYVHGG TAFKQVECSS  180
SIEGFTSTVA LNEPLVLSDD MPTPATYVSG NSNYSTPVNS PYQTTRIEDY DSAMGSDAAS  240
LWMSQNMVLD PSKECPRGRS ISGNYQHVFS NSTLWQPSDH YDFTSSSSFP YFSGEVELSG  300
DLSGYGCVSP FSVHGSYMEF YDDKDISYKG YNQNDLLVNS NLC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-52115712166NO APICAL MERISTEM PROTEIN
1ut4_B3e-52115712166NO APICAL MERISTEM PROTEIN
1ut7_A3e-52115712166NO APICAL MERISTEM PROTEIN
1ut7_B3e-52115712166NO APICAL MERISTEM PROTEIN
4dul_A3e-52115712166NAC domain-containing protein 19
4dul_B3e-52115712166NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC1583081e-163KC158308.1 Solanum lycopersicum AFLP fragment TGG2, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006361176.10.0PREDICTED: NAC domain-containing protein 86-like
SwissprotA4VCM01e-68NAC45_ARATH; NAC domain-containing protein 45
TrEMBLK4C6T80.0K4C6T8_SOLLC; Uncharacterized protein
STRINGSolyc06g061080.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62561635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46590.19e-75NAC domain containing protein 96